PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC01G07980.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 995aa    MW: 108831 Da    PI: 4.8711
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC01G07980.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.41.6e-185197148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +l +av+ + g++Wk+Ia++++  Rt+ qc +rwqk+l
  OPUNC01G07980.1 51 KGNWTPEEDAILSRAVQTYNGKNWKKIAECFP-DRTDVQCLHRWQKVL 97
                     79******************************.************986 PP

2Myb_DNA-binding60.63.3e-19103149148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEd+++v+ v++lG++ W+tIa+ ++ gR +kqc++rw+++l
  OPUNC01G07980.1 103 KGPWSKEEDDIIVQMVNKLGPKKWSTIAQALP-GRIGKQCRERWYNHL 149
                      79******************************.*************97 PP

3Myb_DNA-binding49.11.3e-15155197145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +WT+eE+  lv+a++++G++ W+   + ++ gRt++++k++w+
  OPUNC01G07980.1 155 KEAWTQEEEITLVHAHRMYGNK-WAELTKFLP-GRTDNSIKNHWN 197
                      579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.3834697IPR017930Myb domain
SuperFamilySSF466893.31E-1647103IPR009057Homeodomain-like
SMARTSM007175.1E-175099IPR001005SANT/Myb domain
PfamPF002492.3E-165197IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-2453114IPR009057Homeodomain-like
CDDcd001671.26E-145397No hitNo description
PROSITE profilePS5129430.71298153IPR017930Myb domain
SuperFamilySSF466892.59E-30100196IPR009057Homeodomain-like
SMARTSM007177.7E-18102151IPR001005SANT/Myb domain
PfamPF002492.2E-17103149IPR001005SANT/Myb domain
CDDcd001671.63E-15105149No hitNo description
Gene3DG3DSA:1.10.10.603.2E-25115155IPR009057Homeodomain-like
SMARTSM007173.6E-14154202IPR001005SANT/Myb domain
PROSITE profilePS5129419.65154204IPR017930Myb domain
PfamPF002498.7E-14155198IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-21156204IPR009057Homeodomain-like
CDDcd001676.97E-11157197No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0032875Biological Processregulation of DNA endoreduplication
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 995 aa     Download sequence    Send to blast
MMTSDNGKAP DKSGESSGPP PAPQEGEIST EPKRRRPLNG RTTGPTRRST KGNWTPEEDA  60
ILSRAVQTYN GKNWKKIAEC FPDRTDVQCL HRWQKVLNPE LVKGPWSKEE DDIIVQMVNK  120
LGPKKWSTIA QALPGRIGKQ CRERWYNHLN PGINKEAWTQ EEEITLVHAH RMYGNKWAEL  180
TKFLPGRTDN SIKNHWNSSV KKKVNSYMSS GLLTQVSCLP LNEYSANCNS SPAMTQQNSE  240
DSGCFVVREV ENSSGCSQSS LAKVSCSQVH DTTVPLGCDL QVNANVDKNE AHDSQSSMGP  300
EACYTSVEAV ASALPAVQSH VSSSNLDPDQ HLQDEFAQGL NLDMTIDEMP SVPSFADNQA  360
VCSIENHERS LEPYDIAMEV PLSMLSSDSG AEQKLHFMSE ADFNSPNCLK SELWQDISLQ  420
NLLSGPDAVE ADSFSRSNHQ PGVYSSEADA HFLAPPYMPQ TSNSSSVLGA ADDQSPQMSV  480
PPSLICSNVM IDDAPFDNRS GRKEMPLSQA EVVTQSSSSS GDAEMFANPG SSNDRHVPSS  540
TMESIPECGD QQVTSAEEPE ASLEKEPSLT QSVTAPDEQD KGALFYEPPR FPSLDVPFVS  600
CDLVTSGDLQ EFSPLGIRQL MHSTMNVCTP MRLWGSPTHD ESTGVLLKSA AKSFICTPSI  660
LKKRHRDLLS PIPDKRIEKK YGTEKDRGVS DTSSTGIKTS CINATKDDAL ITTVLRIERS  720
ASSKSLEKKL VFSDENKENL GYTTEQAKDG QSAGNDEHMD EQTRGERRSA RNVATTYDDL  780
SGNLQPAGIL IEHSCDDPVS PDYGKNTMNQ KLNTNVKSLS VCKEGMCAKS KPTELIVEKS  840
SPCINVDYEY VNILADTPGI KRGLESPSAW KSPWFVDMQF QGSYFASPAD RTYDALGLVK  900
QINVQTAAAL AEAREVLASG GQCDNISSDN ENTGNPDAKK EPGTTKLQTK IMAEGRILDF  960
ECTTPVRSSD KNAGSSLGRY LSSPIPSSHL LKSFR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-65512046159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-65512046159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00505DAPTransfer from AT5G11510Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3186010.0AK318601.1 Oryza sativa Japonica Group cDNA, clone: J100066E24, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015625869.10.0PREDICTED: myb-related protein 3R-1 isoform X1
TrEMBLA0A0E0JFX50.0A0A0E0JFX5_ORYPU; Uncharacterized protein
STRINGLOC_Os01g12860.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.11e-138myb domain protein 3r-4